Odocoileus virginianus (white-tailed deer): 110122664
Help
Entry
110122664 CDS
T10722
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
ovr Odocoileus virginianus (white-tailed deer)
Pathway
ovr03050
Proteasome
ovr05010
Alzheimer disease
ovr05012
Parkinson disease
ovr05014
Amyotrophic lateral sclerosis
ovr05016
Huntington disease
ovr05017
Spinocerebellar ataxia
ovr05020
Prion disease
ovr05022
Pathways of neurodegeneration - multiple diseases
ovr05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
ovr00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
110122664 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
110122664 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
110122664 (PSMD7)
05012 Parkinson disease
110122664 (PSMD7)
05014 Amyotrophic lateral sclerosis
110122664 (PSMD7)
05016 Huntington disease
110122664 (PSMD7)
05017 Spinocerebellar ataxia
110122664 (PSMD7)
05020 Prion disease
110122664 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
110122664 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
ovr03051
]
110122664 (PSMD7)
Proteasome [BR:
ovr03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
110122664 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Motif
Other DBs
NCBI-GeneID:
110122664
NCBI-ProteinID:
XP_070307185
LinkDB
All DBs
Position
20:24029702..24039163
Genome browser
AA seq
322 aa
AA seq
DB search
MLELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRGYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEDSKKDR
KDDKEKEKEKSDVKKEEKKEKK
NT seq
969 nt
NT seq
+upstream
nt +downstream
nt
atgctggagctggcggtgcagaaggtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaatcgaataggcaaggttggaaaccaaaaacgtgttgttggtgtgcttttg
gggtcgtggcaaaagaaagtactcgatgtatccaacagttttgcagttccttttgatgaa
gacgacaaagatgattctgtctggtttttagaccatgattacttggaaaacatgtatgga
atgtttaagaaggtcaacgccagagaaagaatagttggatggtaccacacaggccctaaa
ctacacaagaatgacatcgccatcaatgaactcatgaaaagatactgccctaactcagta
ttggtcatcattgatgtgaagccaaaggacctgggactgcccacagaagcatatatttcg
gtggaagaagttcatgatgatggaactccaacctcaaaaacatttgagcacgtgaccagt
gaaattggagctgaggaagccgaggaagttggagttgaacacttgttacgagacatcaaa
gacactacagtgggcactctctcccagcggatcacaaaccaggtccatggtctgaaggga
ctcaactccaagctcctagacatcaggggctacctggagaaggtggccactggcaagctg
cccatcaaccaccagatcatctaccagctgcaggatgtcttcaacctgctgccagatgtc
agcctgcaggaatttgtcaaggccttttacctgaagaccaacgatcagatggtggtggta
tatttggcctcactgatccgttctgtggtcgccttgcacaacctcatcaacaacaagatt
gccaaccgggacgcagaaaagaaagaagggcaagaaaaggaagacagcaaaaaggataga
aaagatgacaaagagaaagagaaggaaaagagtgatgtaaagaaagaagagaaaaaggag
aaaaaataa
DBGET
integrated database retrieval system