Odocoileus virginianus (white-tailed deer): 110134455
Help
Entry
110134455 CDS
T10722
Symbol
CEBPB
Name
(RefSeq) CCAAT/enhancer-binding protein beta
KO
K10048
CCAAT/enhancer binding protein (C/EBP), beta
Organism
ovr Odocoileus virginianus (white-tailed deer)
Pathway
ovr04148
Efferocytosis
ovr04657
IL-17 signaling pathway
ovr04668
TNF signaling pathway
ovr05152
Tuberculosis
ovr05202
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:
ovr00001
]
09130 Environmental Information Processing
09132 Signal transduction
04668 TNF signaling pathway
110134455 (CEBPB)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
110134455 (CEBPB)
09150 Organismal Systems
09151 Immune system
04657 IL-17 signaling pathway
110134455 (CEBPB)
09160 Human Diseases
09161 Cancer: overview
05202 Transcriptional misregulation in cancer
110134455 (CEBPB)
09171 Infectious disease: bacterial
05152 Tuberculosis
110134455 (CEBPB)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
ovr03000
]
110134455 (CEBPB)
Transcription factors [BR:
ovr03000
]
Eukaryotic type
Basic leucine zipper (bZIP)
C/EBP-like factors
110134455 (CEBPB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
bZIP_2
bZIP_1
ATG16
Taxilin
DUF3450
Uds1
CCD48
UPF0242
Nup54
DivIC
bZIP_Maf
Motif
Other DBs
NCBI-GeneID:
110134455
NCBI-ProteinID:
XP_020744654
UniProt:
A0A6J0X8R3
LinkDB
All DBs
Position
9:73046205..73048342
Genome browser
AA seq
350 aa
AA seq
DB search
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
GELGSIGEHERAIDFSPYLEPLGAPQAPAPTTATDTFEAAPPAPAPAPASSGQHHDFLSD
LFSDDYGGKNCKKAADYGYLSLGRLGAAKGALHPGCFAPLHPPPPPPPPPPPAELKAEPG
FEPADCKRKEEAGAPGGGAAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPS
PADAKAPPAAAACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMR
NLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLAASGRC
NT seq
1053 nt
NT seq
+upstream
nt +downstream
nt
atgcaacgcctggtggcctgggacccagcatgtctccccctgccgccgccgccgcccgcc
tttaaatccatggaagtggccaacttctactacgaggcggactgcttggctgctgcgtac
ggcggcaaggcggcccccgcggcgcccccggcggccagacccgggccgcgcccccccgcc
ggcgagctgggtagcatcggtgagcacgagcgcgccatagacttcagcccctacctggag
ccgctgggcgcgccgcaggccccggcacccaccacggccacggacaccttcgaggcggct
ccgcccgcgcccgcccccgcgcccgcctcctccgggcagcaccacgacttcctctccgac
ctcttctccgacgactacgggggcaagaactgcaagaaggcggctgactacggctacctg
agcctgggccgcctgggggctgccaagggcgcgctgcacccgggctgcttcgcgccccta
cacccgccgcccccgccgccgccgccgccgccgccggccgagctcaaggcggagccgggc
ttcgagcccgcggactgcaagcggaaggaggaggccggagcgccgggcggcggcgccgcg
ggcatggcggccggcttcccgtacgcgctgcgcgcctacctcggctaccaggcggtgccg
agcggcagcagcgggagcctgtccacgtcctcgtcgtccagcccgcccggcacgccgagc
cccgccgacgccaaggcgcccccggccgccgccgcctgctacgcgggggcggcgccggcg
ccctcgcaggtcaagagcaaggccaagaagacggtggacaagcacagcgacgagtacaag
atccggcgggagcgcaacaacatcgcggtgcgcaagagccgcgacaaggccaagatgcgt
aacctggagacgcagcacaaggtcctggagctcacggcggagaacgagcggctccagaag
aaagtggagcagctgtcgcgcgagctcagcacgctgcggaacttgttcaagcagctgccc
gagcccctgctcgccgcctccggccgctgctag
DBGET
integrated database retrieval system