KEGG   Odocoileus virginianus (white-tailed deer): 110147721
Entry
110147721         CDS       T10722                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ovr  Odocoileus virginianus (white-tailed deer)
Pathway
ovr01521  EGFR tyrosine kinase inhibitor resistance
ovr01522  Endocrine resistance
ovr01524  Platinum drug resistance
ovr04010  MAPK signaling pathway
ovr04012  ErbB signaling pathway
ovr04014  Ras signaling pathway
ovr04015  Rap1 signaling pathway
ovr04022  cGMP-PKG signaling pathway
ovr04024  cAMP signaling pathway
ovr04062  Chemokine signaling pathway
ovr04066  HIF-1 signaling pathway
ovr04068  FoxO signaling pathway
ovr04071  Sphingolipid signaling pathway
ovr04072  Phospholipase D signaling pathway
ovr04114  Oocyte meiosis
ovr04140  Autophagy - animal
ovr04148  Efferocytosis
ovr04150  mTOR signaling pathway
ovr04151  PI3K-Akt signaling pathway
ovr04210  Apoptosis
ovr04218  Cellular senescence
ovr04261  Adrenergic signaling in cardiomyocytes
ovr04270  Vascular smooth muscle contraction
ovr04350  TGF-beta signaling pathway
ovr04360  Axon guidance
ovr04370  VEGF signaling pathway
ovr04371  Apelin signaling pathway
ovr04380  Osteoclast differentiation
ovr04510  Focal adhesion
ovr04517  IgSF CAM signaling
ovr04520  Adherens junction
ovr04540  Gap junction
ovr04550  Signaling pathways regulating pluripotency of stem cells
ovr04611  Platelet activation
ovr04613  Neutrophil extracellular trap formation
ovr04620  Toll-like receptor signaling pathway
ovr04621  NOD-like receptor signaling pathway
ovr04625  C-type lectin receptor signaling pathway
ovr04650  Natural killer cell mediated cytotoxicity
ovr04657  IL-17 signaling pathway
ovr04658  Th1 and Th2 cell differentiation
ovr04659  Th17 cell differentiation
ovr04660  T cell receptor signaling pathway
ovr04662  B cell receptor signaling pathway
ovr04664  Fc epsilon RI signaling pathway
ovr04666  Fc gamma R-mediated phagocytosis
ovr04668  TNF signaling pathway
ovr04713  Circadian entrainment
ovr04720  Long-term potentiation
ovr04722  Neurotrophin signaling pathway
ovr04723  Retrograde endocannabinoid signaling
ovr04724  Glutamatergic synapse
ovr04725  Cholinergic synapse
ovr04726  Serotonergic synapse
ovr04730  Long-term depression
ovr04810  Regulation of actin cytoskeleton
ovr04910  Insulin signaling pathway
ovr04912  GnRH signaling pathway
ovr04914  Progesterone-mediated oocyte maturation
ovr04915  Estrogen signaling pathway
ovr04916  Melanogenesis
ovr04917  Prolactin signaling pathway
ovr04919  Thyroid hormone signaling pathway
ovr04921  Oxytocin signaling pathway
ovr04926  Relaxin signaling pathway
ovr04928  Parathyroid hormone synthesis, secretion and action
ovr04929  GnRH secretion
ovr04930  Type II diabetes mellitus
ovr04933  AGE-RAGE signaling pathway in diabetic complications
ovr04934  Cushing syndrome
ovr04935  Growth hormone synthesis, secretion and action
ovr04960  Aldosterone-regulated sodium reabsorption
ovr05010  Alzheimer disease
ovr05020  Prion disease
ovr05022  Pathways of neurodegeneration - multiple diseases
ovr05034  Alcoholism
ovr05132  Salmonella infection
ovr05133  Pertussis
ovr05135  Yersinia infection
ovr05140  Leishmaniasis
ovr05142  Chagas disease
ovr05145  Toxoplasmosis
ovr05152  Tuberculosis
ovr05160  Hepatitis C
ovr05161  Hepatitis B
ovr05163  Human cytomegalovirus infection
ovr05164  Influenza A
ovr05165  Human papillomavirus infection
ovr05166  Human T-cell leukemia virus 1 infection
ovr05167  Kaposi sarcoma-associated herpesvirus infection
ovr05170  Human immunodeficiency virus 1 infection
ovr05171  Coronavirus disease - COVID-19
ovr05200  Pathways in cancer
ovr05203  Viral carcinogenesis
ovr05205  Proteoglycans in cancer
ovr05206  MicroRNAs in cancer
ovr05207  Chemical carcinogenesis - receptor activation
ovr05208  Chemical carcinogenesis - reactive oxygen species
ovr05210  Colorectal cancer
ovr05211  Renal cell carcinoma
ovr05212  Pancreatic cancer
ovr05213  Endometrial cancer
ovr05214  Glioma
ovr05215  Prostate cancer
ovr05216  Thyroid cancer
ovr05218  Melanoma
ovr05219  Bladder cancer
ovr05220  Chronic myeloid leukemia
ovr05221  Acute myeloid leukemia
ovr05223  Non-small cell lung cancer
ovr05224  Breast cancer
ovr05225  Hepatocellular carcinoma
ovr05226  Gastric cancer
ovr05230  Central carbon metabolism in cancer
ovr05231  Choline metabolism in cancer
ovr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ovr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ovr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110147721 (MAPK1)
   04012 ErbB signaling pathway
    110147721 (MAPK1)
   04014 Ras signaling pathway
    110147721 (MAPK1)
   04015 Rap1 signaling pathway
    110147721 (MAPK1)
   04350 TGF-beta signaling pathway
    110147721 (MAPK1)
   04370 VEGF signaling pathway
    110147721 (MAPK1)
   04371 Apelin signaling pathway
    110147721 (MAPK1)
   04668 TNF signaling pathway
    110147721 (MAPK1)
   04066 HIF-1 signaling pathway
    110147721 (MAPK1)
   04068 FoxO signaling pathway
    110147721 (MAPK1)
   04072 Phospholipase D signaling pathway
    110147721 (MAPK1)
   04071 Sphingolipid signaling pathway
    110147721 (MAPK1)
   04024 cAMP signaling pathway
    110147721 (MAPK1)
   04022 cGMP-PKG signaling pathway
    110147721 (MAPK1)
   04151 PI3K-Akt signaling pathway
    110147721 (MAPK1)
   04150 mTOR signaling pathway
    110147721 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    110147721 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110147721 (MAPK1)
   04148 Efferocytosis
    110147721 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110147721 (MAPK1)
   04210 Apoptosis
    110147721 (MAPK1)
   04218 Cellular senescence
    110147721 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110147721 (MAPK1)
   04520 Adherens junction
    110147721 (MAPK1)
   04540 Gap junction
    110147721 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110147721 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110147721 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110147721 (MAPK1)
   04613 Neutrophil extracellular trap formation
    110147721 (MAPK1)
   04620 Toll-like receptor signaling pathway
    110147721 (MAPK1)
   04621 NOD-like receptor signaling pathway
    110147721 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    110147721 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    110147721 (MAPK1)
   04660 T cell receptor signaling pathway
    110147721 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    110147721 (MAPK1)
   04659 Th17 cell differentiation
    110147721 (MAPK1)
   04657 IL-17 signaling pathway
    110147721 (MAPK1)
   04662 B cell receptor signaling pathway
    110147721 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    110147721 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    110147721 (MAPK1)
   04062 Chemokine signaling pathway
    110147721 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110147721 (MAPK1)
   04929 GnRH secretion
    110147721 (MAPK1)
   04912 GnRH signaling pathway
    110147721 (MAPK1)
   04915 Estrogen signaling pathway
    110147721 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    110147721 (MAPK1)
   04917 Prolactin signaling pathway
    110147721 (MAPK1)
   04921 Oxytocin signaling pathway
    110147721 (MAPK1)
   04926 Relaxin signaling pathway
    110147721 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    110147721 (MAPK1)
   04919 Thyroid hormone signaling pathway
    110147721 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    110147721 (MAPK1)
   04916 Melanogenesis
    110147721 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110147721 (MAPK1)
   04270 Vascular smooth muscle contraction
    110147721 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110147721 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110147721 (MAPK1)
   04725 Cholinergic synapse
    110147721 (MAPK1)
   04726 Serotonergic synapse
    110147721 (MAPK1)
   04720 Long-term potentiation
    110147721 (MAPK1)
   04730 Long-term depression
    110147721 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    110147721 (MAPK1)
   04722 Neurotrophin signaling pathway
    110147721 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    110147721 (MAPK1)
   04380 Osteoclast differentiation
    110147721 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110147721 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110147721 (MAPK1)
   05206 MicroRNAs in cancer
    110147721 (MAPK1)
   05205 Proteoglycans in cancer
    110147721 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    110147721 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    110147721 (MAPK1)
   05203 Viral carcinogenesis
    110147721 (MAPK1)
   05230 Central carbon metabolism in cancer
    110147721 (MAPK1)
   05231 Choline metabolism in cancer
    110147721 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110147721 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110147721 (MAPK1)
   05212 Pancreatic cancer
    110147721 (MAPK1)
   05225 Hepatocellular carcinoma
    110147721 (MAPK1)
   05226 Gastric cancer
    110147721 (MAPK1)
   05214 Glioma
    110147721 (MAPK1)
   05216 Thyroid cancer
    110147721 (MAPK1)
   05221 Acute myeloid leukemia
    110147721 (MAPK1)
   05220 Chronic myeloid leukemia
    110147721 (MAPK1)
   05218 Melanoma
    110147721 (MAPK1)
   05211 Renal cell carcinoma
    110147721 (MAPK1)
   05219 Bladder cancer
    110147721 (MAPK1)
   05215 Prostate cancer
    110147721 (MAPK1)
   05213 Endometrial cancer
    110147721 (MAPK1)
   05224 Breast cancer
    110147721 (MAPK1)
   05223 Non-small cell lung cancer
    110147721 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110147721 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    110147721 (MAPK1)
   05161 Hepatitis B
    110147721 (MAPK1)
   05160 Hepatitis C
    110147721 (MAPK1)
   05171 Coronavirus disease - COVID-19
    110147721 (MAPK1)
   05164 Influenza A
    110147721 (MAPK1)
   05163 Human cytomegalovirus infection
    110147721 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110147721 (MAPK1)
   05165 Human papillomavirus infection
    110147721 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110147721 (MAPK1)
   05135 Yersinia infection
    110147721 (MAPK1)
   05133 Pertussis
    110147721 (MAPK1)
   05152 Tuberculosis
    110147721 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110147721 (MAPK1)
   05140 Leishmaniasis
    110147721 (MAPK1)
   05142 Chagas disease
    110147721 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110147721 (MAPK1)
   05020 Prion disease
    110147721 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    110147721 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    110147721 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110147721 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110147721 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110147721 (MAPK1)
   04934 Cushing syndrome
    110147721 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110147721 (MAPK1)
   01524 Platinum drug resistance
    110147721 (MAPK1)
   01522 Endocrine resistance
    110147721 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ovr01001]
    110147721 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ovr03036]
    110147721 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ovr04147]
    110147721 (MAPK1)
Enzymes [BR:ovr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110147721 (MAPK1)
Protein kinases [BR:ovr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110147721 (MAPK1)
Chromosome and associated proteins [BR:ovr03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     110147721 (MAPK1)
Exosome [BR:ovr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110147721 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 110147721
NCBI-ProteinID: XP_070331809
UniProt: A0ABM4IVG7
LinkDB
Position
12:67109023..67165217
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaatctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaacgctgagagagataaagatcttgctgcgcttcagacac
gagaacatcattgggatcaatgacattatccgagcgccgaccatcgagcagatgaaagat
gtatacatagtacaggacctcatggaaacagatctctacaagcttttgaagacgcaacac
ctcagcaatgaccatatctgctattttctttaccagatcctcagagggttaaagtatatc
cattcagccaacgtgctgcaccgcgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccacgaccac
acagggttcctgacagagtacgtggccactcgctggtaccgggctccagaaatcatgttg
aattccaagggctacaccaagtccatcgacatctggtccgtgggctgcatcctagccgag
atgctctccaacaggcccatcttccccgggaagcattacctcgaccagctgaaccacatt
ctgggtattcttggatccccatcgcaggaagacctgaattgtataataaatttaaaagct
agaaactatctgctctctcttccacacaaaaataaggtgccgtggaacaggctgttcccg
aacgctgactccaaagctctggatttactggacaaaatgttgacgttcaaccctcacaag
aggatcgaggtggagcaggctctggctcacccgtacctggagcagtactacgacccgagt
gacgagcccgttgccgaagcacccttcaagtttgacatggaattggacgacttgcccaag
gaaaagctcaaagagctcatttttgaagagactgctcgattccagccgggataccgatct
taa

DBGET integrated database retrieval system