KEGG   Odocoileus virginianus (white-tailed deer): 110149624
Entry
110149624         CDS       T10722                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
ovr  Odocoileus virginianus (white-tailed deer)
Pathway
ovr01521  EGFR tyrosine kinase inhibitor resistance
ovr01522  Endocrine resistance
ovr04010  MAPK signaling pathway
ovr04012  ErbB signaling pathway
ovr04014  Ras signaling pathway
ovr04015  Rap1 signaling pathway
ovr04062  Chemokine signaling pathway
ovr04068  FoxO signaling pathway
ovr04071  Sphingolipid signaling pathway
ovr04072  Phospholipase D signaling pathway
ovr04137  Mitophagy - animal
ovr04140  Autophagy - animal
ovr04144  Endocytosis
ovr04150  mTOR signaling pathway
ovr04151  PI3K-Akt signaling pathway
ovr04210  Apoptosis
ovr04211  Longevity regulating pathway
ovr04213  Longevity regulating pathway - multiple species
ovr04218  Cellular senescence
ovr04360  Axon guidance
ovr04370  VEGF signaling pathway
ovr04371  Apelin signaling pathway
ovr04510  Focal adhesion
ovr04540  Gap junction
ovr04550  Signaling pathways regulating pluripotency of stem cells
ovr04625  C-type lectin receptor signaling pathway
ovr04630  JAK-STAT signaling pathway
ovr04650  Natural killer cell mediated cytotoxicity
ovr04660  T cell receptor signaling pathway
ovr04662  B cell receptor signaling pathway
ovr04664  Fc epsilon RI signaling pathway
ovr04714  Thermogenesis
ovr04720  Long-term potentiation
ovr04722  Neurotrophin signaling pathway
ovr04725  Cholinergic synapse
ovr04726  Serotonergic synapse
ovr04730  Long-term depression
ovr04810  Regulation of actin cytoskeleton
ovr04910  Insulin signaling pathway
ovr04912  GnRH signaling pathway
ovr04915  Estrogen signaling pathway
ovr04916  Melanogenesis
ovr04917  Prolactin signaling pathway
ovr04919  Thyroid hormone signaling pathway
ovr04921  Oxytocin signaling pathway
ovr04926  Relaxin signaling pathway
ovr04929  GnRH secretion
ovr04933  AGE-RAGE signaling pathway in diabetic complications
ovr04935  Growth hormone synthesis, secretion and action
ovr05010  Alzheimer disease
ovr05022  Pathways of neurodegeneration - multiple diseases
ovr05034  Alcoholism
ovr05132  Salmonella infection
ovr05160  Hepatitis C
ovr05161  Hepatitis B
ovr05163  Human cytomegalovirus infection
ovr05165  Human papillomavirus infection
ovr05166  Human T-cell leukemia virus 1 infection
ovr05167  Kaposi sarcoma-associated herpesvirus infection
ovr05170  Human immunodeficiency virus 1 infection
ovr05200  Pathways in cancer
ovr05203  Viral carcinogenesis
ovr05205  Proteoglycans in cancer
ovr05206  MicroRNAs in cancer
ovr05207  Chemical carcinogenesis - receptor activation
ovr05208  Chemical carcinogenesis - reactive oxygen species
ovr05210  Colorectal cancer
ovr05211  Renal cell carcinoma
ovr05213  Endometrial cancer
ovr05214  Glioma
ovr05215  Prostate cancer
ovr05216  Thyroid cancer
ovr05218  Melanoma
ovr05219  Bladder cancer
ovr05220  Chronic myeloid leukemia
ovr05221  Acute myeloid leukemia
ovr05223  Non-small cell lung cancer
ovr05224  Breast cancer
ovr05225  Hepatocellular carcinoma
ovr05226  Gastric cancer
ovr05230  Central carbon metabolism in cancer
ovr05231  Choline metabolism in cancer
ovr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ovr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ovr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110149624 (HRAS)
   04012 ErbB signaling pathway
    110149624 (HRAS)
   04014 Ras signaling pathway
    110149624 (HRAS)
   04015 Rap1 signaling pathway
    110149624 (HRAS)
   04370 VEGF signaling pathway
    110149624 (HRAS)
   04371 Apelin signaling pathway
    110149624 (HRAS)
   04630 JAK-STAT signaling pathway
    110149624 (HRAS)
   04068 FoxO signaling pathway
    110149624 (HRAS)
   04072 Phospholipase D signaling pathway
    110149624 (HRAS)
   04071 Sphingolipid signaling pathway
    110149624 (HRAS)
   04151 PI3K-Akt signaling pathway
    110149624 (HRAS)
   04150 mTOR signaling pathway
    110149624 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110149624 (HRAS)
   04140 Autophagy - animal
    110149624 (HRAS)
   04137 Mitophagy - animal
    110149624 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    110149624 (HRAS)
   04218 Cellular senescence
    110149624 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110149624 (HRAS)
   04540 Gap junction
    110149624 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    110149624 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110149624 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110149624 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    110149624 (HRAS)
   04660 T cell receptor signaling pathway
    110149624 (HRAS)
   04662 B cell receptor signaling pathway
    110149624 (HRAS)
   04664 Fc epsilon RI signaling pathway
    110149624 (HRAS)
   04062 Chemokine signaling pathway
    110149624 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110149624 (HRAS)
   04929 GnRH secretion
    110149624 (HRAS)
   04912 GnRH signaling pathway
    110149624 (HRAS)
   04915 Estrogen signaling pathway
    110149624 (HRAS)
   04917 Prolactin signaling pathway
    110149624 (HRAS)
   04921 Oxytocin signaling pathway
    110149624 (HRAS)
   04926 Relaxin signaling pathway
    110149624 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    110149624 (HRAS)
   04919 Thyroid hormone signaling pathway
    110149624 (HRAS)
   04916 Melanogenesis
    110149624 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    110149624 (HRAS)
   04726 Serotonergic synapse
    110149624 (HRAS)
   04720 Long-term potentiation
    110149624 (HRAS)
   04730 Long-term depression
    110149624 (HRAS)
   04722 Neurotrophin signaling pathway
    110149624 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    110149624 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    110149624 (HRAS)
   04213 Longevity regulating pathway - multiple species
    110149624 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    110149624 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110149624 (HRAS)
   05206 MicroRNAs in cancer
    110149624 (HRAS)
   05205 Proteoglycans in cancer
    110149624 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    110149624 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    110149624 (HRAS)
   05203 Viral carcinogenesis
    110149624 (HRAS)
   05230 Central carbon metabolism in cancer
    110149624 (HRAS)
   05231 Choline metabolism in cancer
    110149624 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110149624 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110149624 (HRAS)
   05225 Hepatocellular carcinoma
    110149624 (HRAS)
   05226 Gastric cancer
    110149624 (HRAS)
   05214 Glioma
    110149624 (HRAS)
   05216 Thyroid cancer
    110149624 (HRAS)
   05221 Acute myeloid leukemia
    110149624 (HRAS)
   05220 Chronic myeloid leukemia
    110149624 (HRAS)
   05218 Melanoma
    110149624 (HRAS)
   05211 Renal cell carcinoma
    110149624 (HRAS)
   05219 Bladder cancer
    110149624 (HRAS)
   05215 Prostate cancer
    110149624 (HRAS)
   05213 Endometrial cancer
    110149624 (HRAS)
   05224 Breast cancer
    110149624 (HRAS)
   05223 Non-small cell lung cancer
    110149624 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110149624 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    110149624 (HRAS)
   05161 Hepatitis B
    110149624 (HRAS)
   05160 Hepatitis C
    110149624 (HRAS)
   05163 Human cytomegalovirus infection
    110149624 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110149624 (HRAS)
   05165 Human papillomavirus infection
    110149624 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110149624 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110149624 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    110149624 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    110149624 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110149624 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110149624 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110149624 (HRAS)
   01522 Endocrine resistance
    110149624 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ovr04131]
    110149624 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ovr04147]
    110149624 (HRAS)
   04031 GTP-binding proteins [BR:ovr04031]
    110149624 (HRAS)
Membrane trafficking [BR:ovr04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    110149624 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110149624 (HRAS)
Exosome [BR:ovr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110149624 (HRAS)
  Exosomal proteins of colorectal cancer cells
   110149624 (HRAS)
GTP-binding proteins [BR:ovr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110149624 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N CdhD AAA_16
Other DBs
NCBI-GeneID: 110149624
NCBI-ProteinID: XP_020767805
UniProt: A0A6J0Z100
LinkDB
Position
28:44412370..44416275
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINHAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKARKLSPPDEGGPG
CLSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggcgccggcggcgtggggaagagcgccctgacc
atccagctcatccagaaccacttcgtggatgagtacgaccccaccatcgaggactcctat
cggaagcaagtggtcatcgatggggagacgtgcctgctggacatcctggacacggcgggc
caggaggagtatagcgccatgcgggaccagtacatgcgcaccggggagggcttcctctgc
gtgtttgccatcaaccacgccaagtccttcgaggacatccaccagtaccgggagcagatc
aagcgggtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgcgacctg
gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctatggcatcccg
tacatcgagacctccgctaagacccgccagggcgtggaggatgctttctacaccctggta
cgcgagatccggcagcacaaagcgcgcaagctgagcccgccggacgagggcggccccggc
tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system