Paracoccus sp. AK26: FIU66_00380 Help Entry FIU66_00380       CDS       T08451                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism paak  Paracoccus sp. AK26 Brite KEGG Orthology (KO) [BR:paak00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:paak03036]     FIU66_00380    03400 DNA repair and recombination proteins [BR:paak03400]     FIU66_00380 Chromosome and associated proteins [BR:paak03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     FIU66_00380 DNA repair and recombination proteins [BR:paak03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       FIU66_00380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS K-box Histone_HNS_N PspAA ABATE DUF3829 Motif Other DBs NCBI-ProteinID:  QIR83790 UniProt:  A0A6G9W4Z7 LinkDB All DBs Position 88654..88965 Genome browser AA seq 103 aa AA seqDB search MNFDLDKMTLKELRDLRAKLDRAINSYEDRKRREALAAIEEAAREHGFNLSELTGAKPKR SGTVAPKYANPSDPTMTWTGRGRKPRWVQESLEGGKELDDLLI NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaactttgatctcgacaagatgacgctcaaggagttgcgtgatcttcgggctaaactg gaccgcgcgattaactcttatgaagatcgtaaacggcgcgaagctttggctgcgatagag gaagccgcgcgcgaacacggtttcaatctgtccgaattgaccggtgcaaagccgaagcgt tccggtacggtcgctccgaaatatgcaaatcccagtgatccgacgatgacctggaccggc cggggacgcaaaccccgctgggtgcaggaaagccttgaaggcggcaaggaactggacgat ctgctgatctga

DBGET integrated database retrieval system