Paracoccus sp. AK26: FIU66_04740 Help Entry FIU66_04740       CDS       T08451                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paak  Paracoccus sp. AK26 Pathway paak01100   Metabolic pathways paak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIU66_04740    00074 Mycolic acid biosynthesis     FIU66_04740   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIU66_04740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QIR84577 UniProt:  A0A6G9W621 LinkDB All DBs Position 974392..974658 Genome browser AA seq 88 aa AA seqDB search MTDQIRNRIRAIIAEQAMLEPDQITDHSTPQDLGIDSLGLVESIFAIEEEFDISIPFNAN EPDKSDFDISNMGTIMAAVERLVAQKAA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaccgaccagatcaggaaccgcatccgggccatcatcgccgaacaggccatgctggaa cccgaccagatcaccgaccattccacccctcaggacttgggcatcgacagccttggcctg gtcgaatcgatcttcgccatcgaggaggaattcgacatctcgatcccgttcaacgccaat gaaccggacaagtctgacttcgacatctcgaacatgggcacgatcatggccgcggtcgaa cggctggtggcgcagaaggccgcatga

DBGET integrated database retrieval system