Paracoccus sp. AK26: FIU66_12770 Help Entry FIU66_12770       CDS       T08451                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paak  Paracoccus sp. AK26 Pathway paak01100   Metabolic pathways paak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIU66_12770    00074 Mycolic acid biosynthesis     FIU66_12770   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIU66_12770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QIR86004 LinkDB All DBs Position complement(2574281..2574514) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVVESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTVGDAVTFIKGAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgatcgcgtgaagaagatcgtggtcgagcatctgggcgtcgaggaa gacaaggtggtcgaatccgcctcgttcatcgacgacctgggggccgacagcctcgacacc gtcgagctggtcatggcgttcgaggaagaattcgggatcgagatcccggacgacgccgcc gaaaccatccagaccgtcggcgatgcggtgaccttcatcaagggcgcggtctga

DBGET integrated database retrieval system