Parabacteroides absconsus: NEE14_002505 Help Entry NEE14_002505      CDS       T10821                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pabc  Parabacteroides absconsus Pathway pabc00020   Citrate cycle (TCA cycle) pabc00720   Other carbon fixation pathways pabc01100   Metabolic pathways pabc01110   Biosynthesis of secondary metabolites pabc01120   Microbial metabolism in diverse environments pabc01200   Carbon metabolism pabc01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pabc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     NEE14_002505   09102 Energy metabolism    00720 Other carbon fixation pathways     NEE14_002505 Enzymes [BR:pabc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      NEE14_002505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_6 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_17 Fer4_15 Fer4_22 Fer4_8 Fer4_13 Fer4_3 Fer4_18 Motif Other DBs NCBI-ProteinID:  WWV66882 LinkDB All DBs Position complement(596864..597094) Genome browser AA seq 76 aa AA seqDB search MAKFRGAVVVNTERCKGCNLCVVACPADVLELHPREVNNKGYHYVYMKHPDNCIGCASCG LVCPDGCLTVYKKKID NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaaaattcagaggcgccgtcgtagtgaataccgagcgttgcaaaggttgtaatctt tgcgtagtagcctgtccggctgatgtattggaattacacccgcgggaagttaacaacaaa ggttaccattatgtatacatgaagcatcccgataactgcattgggtgtgcaagttgtgga ctagtatgtccagacggatgtttaacagtctataaaaagaaaattgattga

DBGET integrated database retrieval system