Pyrodictium abyssi: PABY_22930 Help Entry PABY_22930        CDS       T09712                                  Name (GenBank) hypothetical protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism pabi  Pyrodictium abyssi Pathway pabi00290   Valine, leucine and isoleucine biosynthesis pabi00650   Butanoate metabolism pabi00660   C5-Branched dibasic acid metabolism pabi00770   Pantothenate and CoA biosynthesis pabi01100   Metabolic pathways pabi01110   Biosynthesis of secondary metabolites pabi01210   2-Oxocarboxylic acid metabolism pabi01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:pabi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     PABY_22930    00660 C5-Branched dibasic acid metabolism     PABY_22930   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     PABY_22930   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     PABY_22930 Enzymes [BR:pabi01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      PABY_22930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  BES82726 LinkDB All DBs Position 2090636..2090887 Genome browser AA seq 83 aa AA seqDB search MASQCTGIYVIEVSAFNGMDAVMRLSNMARRAKLEYRNISASFDGRVVRLRIEAAGEEKE VHWLAAKMERMPEVYAVAAKRLS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtggccagccagtgcaccgggatatacgtgatagaggtatccgcgttcaacgggatggac gccgtaatgaggctaagcaatatggcgcgccgagctaagctagagtaccgcaacatatcc gccagcttcgatggcagagtggtccggctgagaatagaagcggctggcgaggagaaggag gtacactggctagcagccaagatggagaggatgcccgaggtctacgcggtagcagccaag aggctatcgtga

DBGET integrated database retrieval system