KEGG   Salipiger abyssi: Ga0080574_TMP1945
Entry
Ga0080574_TMP1945 CDS       T04681                                 
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
paby  Salipiger abyssi
Pathway
paby02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:paby00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Ga0080574_TMP1945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paby02044]
    Ga0080574_TMP1945
Secretion system [BR:paby02044]
 Type IV secretion system
  Trb secretion system protein
   Ga0080574_TMP1945
SSDB
Motif
Pfam: DUF948 DUF3535 Mod_r AAA_27 dCache_1 Laminin_II
Other DBs
NCBI-ProteinID: APZ52279
UniProt: A0A1P8V0L6
LinkDB
Position
complement(1287749..1288531)
AA seq 260 aa
MTRKITFRSAGTSLLALALAMPMAMSPIAAPPAQALFGIGGGPFIVYDPTNHAENLLTAA
RALEQINNQIAQLQNEAQMLINQARNLANLPYSALQQIQQNVSRTQQLLAQAQNIAFDVQ
SIDQMFQQDYGNLSLAATDQQLIAEARSRWENTVGGLQDAMRVQAGVVGNIDANRAEMSA
LVGQSQNAVGALQATQAGNQLLALQSQQLSDVIAVISANGRANALTEAERATAAEQGRIQ
RERFLTPGSGYQPGNAQMFN
NT seq 783 nt   +upstreamnt  +downstreamnt
atgacacgcaagattacgtttcggtccgcgggcacttcgctgctcgccctcgcgctggcg
atgcccatggccatgtcgcccatcgcagcgccgcctgcgcaggcgctcttcggcatcggc
ggggggcctttcatcgtctacgatccgaccaaccacgccgaaaatctcctgaccgcggcg
cgcgctctggagcagatcaacaaccagatcgcacagctccagaacgaagcgcagatgctg
atcaaccaggcgcgcaatctcgccaacctgccgtattccgcgctccagcagatccagcag
aacgtcagccgcacacagcaactcctggcgcaggcgcagaacatcgccttcgacgtgcag
agcatcgaccagatgttccagcaggattatggcaacctttccctggcggcgaccgaccag
caactgatcgccgaggcccggtcccgttgggagaacaccgtcggtggcctccaggatgcg
atgcgcgtgcaggcaggtgtcgtcggcaatatcgatgccaaccgcgcagagatgtctgca
cttgtagggcagagccagaacgcggtcggtgctcttcaggccacacaggcgggcaaccag
ctcctcgcactgcaatcgcagcagctctcggacgtgatcgcggtgatctcggcaaacggc
cgcgccaatgcgctgaccgaggccgagcgcgccactgctgcggaacagggccgcatccag
cgcgagcgcttcctgacgccgggttcgggctaccagcccggtaacgcgcagatgttcaac
tga

DBGET integrated database retrieval system