Salipiger abyssi: Ga0080574_TMP4470 Help Entry Ga0080574_TMP4470 CDS       T04681                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paby  Salipiger abyssi Pathway paby01100   Metabolic pathways paby01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paby00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ga0080574_TMP4470    00074 Mycolic acid biosynthesis     Ga0080574_TMP4470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ga0080574_TMP4470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  APZ54804 UniProt:  A0A1P8UZI3 LinkDB All DBs Position complement(3886872..3887132) Genome browser AA seq 86 aa AA seqDB search MSVKDRVIAIIAEQAVLEPSDVTMDSTLEDLGIDSLGLVESIFAIEEAFDISVPFNANEP EQSDFDISSVATIVAGIEKLIAEQAK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagtgtgaaggaccgggtgatcgcgattatcgccgaacaggccgttctggaaccatcg gacgtgacgatggacagcacgctggaggatctgggcatcgacagcctcggcctcgtggag agcatctttgccatcgaggaagcctttgatatctcggtgccgttcaacgccaacgagccc gagcagagcgatttcgacatctcgtcggtggcgaccatcgtcgccgggatcgaaaagctc atcgccgagcaggccaagtga

DBGET integrated database retrieval system