Candidatus Odyssella acanthamoebae: ID47_05905 Help Entry ID47_05905        CDS       T03232                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paca  Candidatus Odyssella acanthamoebae Pathway paca01100   Metabolic pathways paca01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paca00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ID47_05905    00074 Mycolic acid biosynthesis     ID47_05905   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ID47_05905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIK96366 UniProt:  A0A077AVE3 LinkDB All DBs Position 1242697..1242951 Genome browser AA seq 84 aa AA seqDB search MNDLETKIKQLIIDSLNLEDISIDDIDSTEALFVDGLGLDSIDALELGVVLQKEFNIKIK VQDDEIKKHFYSVRALAEFVSNQH NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaatgatttagaaacaaaaattaagcagcttattattgattcgctgaacctagaagat attagcattgacgatattgacagcacagaggcactgtttgtggatgggttaggtttagac tccattgatgctttagaattaggtgtcgtcctgcagaaagaatttaatattaaaattaag gttcaggatgatgagattaaaaaacatttttattcagtaagggcacttgctgaatttgta agcaatcaacactaa

DBGET integrated database retrieval system