Candidatus Odyssella acanthamoebae: ID47_05910 Help Entry ID47_05910        CDS       T03232                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paca  Candidatus Odyssella acanthamoebae Pathway paca01100   Metabolic pathways paca01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paca00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ID47_05910    00074 Mycolic acid biosynthesis     ID47_05910   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ID47_05910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIK96367 UniProt:  A0A077AT33 LinkDB All DBs Position 1242962..1243210 Genome browser AA seq 82 aa AA seqDB search MTKNEIFNQISDYLEEYFEIPRTSITLEAKLFEELDLDSIDAVDLIVKLQELAKKKISPT EFKQVRIVGDVVNKVHDLVHQE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacgaaaaatgaaattttcaatcaaatttcagactatcttgaagagtactttgaaatt cctcgcacttcaattaccctggaagcaaaactattcgaagaattagatttggatagcatt gatgctgtggatttaatcgtaaagctacaagaattggcaaagaaaaaaatctccccaact gagttcaaacaagtccggatagtgggtgatgttgttaacaaggtacacgatcttgtccac caagaataa

DBGET integrated database retrieval system