Propionibacterium acidifaciens: EGX94_11640 Help Entry EGX94_11640       CDS       T05713                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism pacd  Propionibacterium acidifaciens Pathway pacd01056   Biosynthesis of type II polyketide backbone pacd01100   Metabolic pathways pacd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pacd00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     EGX94_11640    00253 Tetracycline biosynthesis     EGX94_11640  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:pacd01004]     EGX94_11640    01008 Polyketide biosynthesis proteins [BR:pacd01008]     EGX94_11640 Lipid biosynthesis proteins [BR:pacd01004]  Polyketide synthase   Component type    EGX94_11640 Polyketide biosynthesis proteins [BR:pacd01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      EGX94_11640     Nonaketide PKS      EGX94_11640     Decaketide PKS      EGX94_11640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AYW78631 UniProt:  A0A3G5HTW8 LinkDB All DBs Position 2753257..2753517 Genome browser AA seq 86 aa AA seqDB search MKSLTLEELRILMAGVLDDPVDLPSGFDSIPFTDLGYDSLAMMAMSAMLMERYGIDVPRN VLRALRTPADLLECINDGFCSSGRVV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaaatcactaacgctcgaggagctgaggatcctcatggctggcgtcttggatgaccct gtagacctgccgtcggggtttgattccataccatttacggacttggggtatgactcattg gcaatgatggcgatgagtgccatgctcatggaacgttatggcatcgatgttcccagaaat gtcttgcgtgcattgcgcacccccgcggacctgttggaatgcatcaatgatggtttctgt tcaagtgggcgggtggtgtga

DBGET integrated database retrieval system