Syntrophotalea acetylenica: A6070_01260 Help Entry A6070_01260       CDS       T04585                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pace  Syntrophotalea acetylenica Pathway pace00190   Oxidative phosphorylation pace01100   Metabolic pathways Module pace_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pace00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     A6070_01260  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pace00194]     A6070_01260 Photosynthesis proteins [BR:pace00194]  Photosystem and electron transport system   F-type ATPase [OT]    A6070_01260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  APG42910 UniProt:  A0A1L3GG36 LinkDB All DBs Position 271575..271859 Genome browser AA seq 94 aa AA seqDB search MDYLAWVAVASILSSGICIGIGAIGPALGEGRALAQALSALAQQPDEANTITRTLFVGLA MVESTAIYCFVVSMILIFANPFWQFFLARAGEGG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggattatcttgcatgggtggctgtagcgtccattctgtcttcggggatctgcatcggt atcggcgccatcggtcccgctctcggtgagggtcgagccctggcgcaggcgctgtcggcg ctggcgcaacagccggatgaggccaacaccatcacccggaccctgtttgtggggctggcg atggttgaatcgacggctatttactgcttcgtggtttccatgattctgatctttgccaat ccgttctggcagtttttcctggcaagggccggagaaggaggctga

DBGET integrated database retrieval system