KEGG   Paraburkholderia acidiphila: FAZ97_07900
Entry
FAZ97_07900       CDS       T07262                                 
Name
(GenBank) hypothetical protein
Organism
pacp  Paraburkholderia acidiphila
SSDB
Other DBs
NCBI-ProteinID: QGZ54848
UniProt: A0A7Z2J8P7
LinkDB
Position
1:1765333..1765707
AA seq 124 aa
MTGKGTGAAGSQQDAGHLRLVPILYEQQTLRATSMKKRWIVSSLAVFLATIYFTAVEATV
PEEAFTSCAPAMHDDQPLPFLSNDDLDRCMLSKGYAYAGTALANSCSASRSASCYHKVLS
RRDL
NT seq 375 nt   +upstreamnt  +downstreamnt
gtgaccggcaagggcaccggagccgccggttcacaacaagacgccggacaccttcgcctt
gtaccaattctgtacgagcagcagactcttcgcgccacaagcatgaaaaaaagatggatt
gtttcgtcgctcgcggtttttcttgcgacgatctatttcaccgcagtagaagcgactgtc
cctgaagaagcctttacgtcatgcgcgccggcaatgcatgacgatcagccgctgccgttt
ctttcgaacgacgacctggaccggtgcatgctctcaaaaggctacgcatacgcggggacc
gctttggcaaattcttgttcggccagtcgcagcgccagttgctatcacaaggtcttgtct
cggcgcgacctctag

DBGET integrated database retrieval system