Paraburkholderia acidiphila: FAZ97_14280 Help Entry FAZ97_14280       CDS       T07262                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pacp  Paraburkholderia acidiphila Brite KEGG Orthology (KO) [BR:pacp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pacp03032]     FAZ97_14280    03036 Chromosome and associated proteins [BR:pacp03036]     FAZ97_14280    03400 DNA repair and recombination proteins [BR:pacp03400]     FAZ97_14280 DNA replication proteins [BR:pacp03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FAZ97_14280 Chromosome and associated proteins [BR:pacp03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FAZ97_14280 DNA repair and recombination proteins [BR:pacp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FAZ97_14280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Motif Other DBs NCBI-ProteinID:  QGZ55985 UniProt:  A0A7Z2JAI2 LinkDB All DBs Position 1:3139452..3139730 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAQTGASKAQTGETLDTLLEVVKKAVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaataaacaggaactgatcgacgccgtcgcagcacagacgggcgctagcaaggcacaa accggcgagacgctggacacgctcctcgaagtggtcaagaaggctgtgtcgaagggtgac gcggttcagctgatcggcttcggcagcttcggttcgggcaagcgcgcagcccgtacgggc cgtaacccgaagaccggcgaaaccatcaagattcccgcagccaagaccgtcaagttcacg gctggcaaggcgttcaaggacgccgtcaacaagcgctaa

DBGET integrated database retrieval system