Paraburkholderia acidiphila: FAZ97_17105 Help Entry FAZ97_17105       CDS       T07262                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism pacp  Paraburkholderia acidiphila Brite KEGG Orthology (KO) [BR:pacp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pacp03036]     FAZ97_17105    03400 DNA repair and recombination proteins [BR:pacp03400]     FAZ97_17105 Chromosome and associated proteins [BR:pacp03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     FAZ97_17105 DNA repair and recombination proteins [BR:pacp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       FAZ97_17105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF4258 Histone_HNS_N Motif Other DBs NCBI-ProteinID:  QGZ56684 UniProt:  A0A7Z2G7V7 LinkDB All DBs Position 2:594960..595190 Genome browser AA seq 76 aa AA seqDB search MFDLDGEARERLIVWIRRRMEEYGITFEELEASIAESEKIPKYRDAYGNTWNGEGDMPSW LLRYKHAGQDIEHFRC NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgttcgacctcgatggagaggcgcgcgaacggctcatcgtgtggattcgacgccgcatg gaagagtacggcattacgttcgaagagcttgaagcgtctattgccgaaagcgaaaaaata cccaagtaccgcgacgcttacgggaatacgtggaatggcgagggcgatatgccgtcctgg ctgttgcgctataagcacgcgggacaggatatcgagcattttcgctgctag

DBGET integrated database retrieval system