Paraburkholderia acidiphila: FAZ97_18880 Help Entry FAZ97_18880       CDS       T07262                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pacp  Paraburkholderia acidiphila Pathway pacp00998   Biosynthesis of various antibiotics pacp01100   Metabolic pathways pacp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pacp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FAZ97_18880    00074 Mycolic acid biosynthesis     FAZ97_18880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FAZ97_18880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Raf1_N Motif Other DBs NCBI-ProteinID:  QGZ57010 UniProt:  A0A7Z2G8J7 LinkDB All DBs Position 2:959320..959571 Genome browser AA seq 83 aa AA seqDB search MSEAEILDRIREIFHENFDIDPARVTPEAHLFEELDLDSIDAVDLAIKLQEMTGRRIKPE EFKQVRTVGDVIAAVESLLVTQA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagctgaaattctcgaccgtatccgcgagatcttccacgaaaacttcgacatc gatccggcgcgcgtgacgccggaggcgcacctgttcgaggaactggatctggacagcatc gacgccgtcgatctggcgatcaaactgcaggaaatgacgggccgccgcatcaagccggaa gagttcaagcaggtgcgcacggtgggcgacgtgatcgccgcggtcgagtcgctgctcgtc acccaggcttga

DBGET integrated database retrieval system