Pigmentiphaga aceris: FXN63_18620 Help Entry FXN63_18620       CDS       T06198                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pacr  Pigmentiphaga aceris Pathway pacr01100   Metabolic pathways pacr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pacr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FXN63_18620    00074 Mycolic acid biosynthesis     FXN63_18620   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FXN63_18620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DIMCO_N ACP_SdgA_C EAL Motif Other DBs NCBI-ProteinID:  QEI07627 UniProt:  A0A5C0B4X0 LinkDB All DBs Position 4292348..4292599 Genome browser AA seq 83 aa AA seqDB search MQSREQLFGTLRDTLVELFELEPERISLDARLYDDLEIDSIDAIDLIDQMKRQTGKKITA EDFRSVRTVRDVIDAMQRLGEPA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcaaagccgcgaacaactcttcgggaccttgcgcgatacgctcgtagagctgttcgaa ctggaacccgagcgcatctcgctcgacgcccgtctgtatgacgatctggaaatcgacagc atcgacgccatcgacctgatcgaccagatgaaacgccagaccggcaagaaaatcacggca gaagacttccgctcggtacgcaccgtgcgtgacgtgatcgacgccatgcagcggctcggc gagcccgcatga

DBGET integrated database retrieval system