KEGG   Pigmentiphaga aceris: FXN63_25850
Entry
FXN63_25850       CDS       T06198                                 
Name
(GenBank) PLP-dependent aminotransferase family protein
Organism
pacr  Pigmentiphaga aceris
SSDB
Motif
Pfam: Aminotran_1_2 GntR Asp_aminotransf HTH_Crp_2 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1
Other DBs
NCBI-ProteinID: QEI08897
UniProt: A0A5C0B7X4
LinkDB
Position
complement(5984784..5986118)
AA seq 444 aa
MAQARYKQLVDVFAADIRSGRLSPGTRLPTHRKLADEHGLALVTATRVYAELETMGLVSG
EPGRGTFVRETYLPRNQGIDQHAVAPDMVDLNFNYPSLPGQANLLRDGLRQLAAGGDLDA
LLRYQPHGGRMHERASVARHLLSRGLTVSAEQVMIVNGAQQGLATAVMALLQPGDVVAAD
ALTYPGFKVLAEAHRLELAPISPAENGPDLDALDRLCRKRRVRAVYTMPTLHNPLGWVMD
ADQRAQLVALARKHGLLIIEDAAYAFLADDSLPPLAALAPDITVYVSGLSKTVATGLRVG
FVAAPLALVPKLERAIRSTTWNTPGVMTAIACGWLDDGTVTRLEAEKRLDATTRQAIAAK
ALDGLPIVRHPTSYFVWLPLGEECRADQLAATLLRERIAVSTAEPFATTDHVPHAIRLAL
GSVSLESLGDALRKVRRAVDAQGY
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggctcaggcccgctacaagcagttggtggatgtgtttgcggcggatatccgcagcggg
cggctgtcgccgggtacacgcctgcctacccacagaaagctcgccgatgaacatgggttg
gcgctggtcactgccacccgcgtctatgcggagctggaaaccatgggcctggtcagtggc
gagccgggccggggcacatttgtgcgcgagacataccttccgcgcaaccagggcatcgat
cagcatgccgtggcaccggacatggtcgatctgaatttcaactatccgtccttgcccggt
caggcgaacctgctgcgtgatggtttgcgccagctggcagccgggggtgacctggacgcc
ttgctgcgctaccagccgcatggtggccgcatgcacgagcgggcaagcgtggccaggcat
ttgctgtcgcgcgggctgacggtgagcgccgagcaggtaatgattgtgaacggtgcccag
caaggtctggcgactgctgtgatggcgctgctgcaaccgggcgatgtggtggcggcggat
gcgctgacctatcccggtttcaaggtactggcagaagcccaccggctggaactggcaccg
atctcaccagcggaaaacggtcccgatctggatgcgctggaccgcctgtgtcgcaaacgt
cgcgtgcgcgccgtctacaccatgccaacgctgcacaacccacttggctgggtgatggat
gcggaccaacgtgcgcaactggtggcgcttgcccgcaagcacgggttgttgatcatcgaa
gatgcggcctatgcgtttctggccgacgattccttgccgcccttggccgcgcttgcaccg
gacatcacggtatacgtgtcgggcctgtccaagactgttgctaccggtttgcgggtcggg
tttgtcgccgcgccgctggccttggtgccgaagcttgaacgcgcgatccggtctaccacc
tggaatacaccgggcgtgatgacggcaatcgcctgcggctggctggatgacggcacagtt
acgcgcttggaggcagaaaagcgcctggacgcaaccacgcgacaagccattgccgccaag
gcgctggacggactgccgatcgtgcggcatccgacgtcttacttcgtctggttgccgctt
ggcgaggagtgtcgtgccgatcagctggccgcgacgttgctgcgtgagcggattgcggtg
tccaccgccgagccttttgcaaccacggaccatgtgccgcatgcgattcggctggcactg
gggtcggtcagtctggaaagcttgggcgacgcgctgcgcaaggtcaggcgtgcggtggat
gcgcaggggtattga

DBGET integrated database retrieval system