Paraburkholderia acidisoli: FAZ98_09335 Help Entry FAZ98_09335       CDS       T07287                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pacs  Paraburkholderia acidisoli Pathway pacs00998   Biosynthesis of various antibiotics pacs01100   Metabolic pathways pacs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pacs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FAZ98_09335 (acpP)    00074 Mycolic acid biosynthesis     FAZ98_09335 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FAZ98_09335 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  QGZ61916 UniProt:  A0A7Z2GHK6 LinkDB All DBs Position 1:complement(2141342..2141581) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacagcgcgtcaagaagatcgtcgccgagcaactgggcgtcgccgaa gctgaaatcaagaacgaagcttcgttcgtgaacgatctgggcgccgactcgctcgacacc gtcgaactggtgatggccctcgaagacgaattcggcatggaaatcccggacgaggaagcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcctga

DBGET integrated database retrieval system