Paraburkholderia acidisoli: FAZ98_14125 Help Entry FAZ98_14125       CDS       T07287                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pacs  Paraburkholderia acidisoli Brite KEGG Orthology (KO) [BR:pacs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pacs03032]     FAZ98_14125    03036 Chromosome and associated proteins [BR:pacs03036]     FAZ98_14125    03400 DNA repair and recombination proteins [BR:pacs03400]     FAZ98_14125 DNA replication proteins [BR:pacs03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FAZ98_14125 Chromosome and associated proteins [BR:pacs03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FAZ98_14125 DNA repair and recombination proteins [BR:pacs03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FAZ98_14125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  QGZ62774 UniProt:  A0A7Z2GJT4 LinkDB All DBs Position 1:3201593..3201871 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGQTGASKAQTGETLDTLLEVIKKSVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaataaacaggaactgatcgatgccgtcgcgggacagacgggcgcaagcaaggcacaa accggcgaaacgctggacacgcttctcgaagtgatcaagaagtcggtgtcgaagggcgac gcagtgcagctgatcggcttcggcagcttcggttcgggcaagcgtgcagcgcgtacgggt cgcaacccgaagaccggcgaaaccatcaagattcccgcagccaagaccgtcaagttcacg gctggcaaggcgttcaaggacgccgtcaacaagcgctaa

DBGET integrated database retrieval system