Paraburkholderia acidisoli: FAZ98_21970 Help Entry FAZ98_21970       CDS       T07287                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism pacs  Paraburkholderia acidisoli Brite KEGG Orthology (KO) [BR:pacs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pacs03036]     FAZ98_21970    03400 DNA repair and recombination proteins [BR:pacs03400]     FAZ98_21970 Chromosome and associated proteins [BR:pacs03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     FAZ98_21970 DNA repair and recombination proteins [BR:pacs03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       FAZ98_21970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  QGZ64390 UniProt:  A0A7Z2GMR5 LinkDB All DBs Position 2:1770407..1770637 Genome browser AA seq 76 aa AA seqDB search MFDLDGEARERLIVWIKRRMEEYAITLEELEAFIAESEKLPKYRDAYGNSWNGEGDMPTW LLRYKHAGQDIEHFRC NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgttcgacctcgacggagaggcgcgcgaacggctcatcgtgtggattaaacgccgcatg gaagagtacgccattacgctcgaagagcttgaagcgttcatcgccgaaagcgaaaaacta ccgaagtaccgcgacgcatacggcaatagctggaatggcgaaggcgacatgcccacctgg ctactgcgttataagcatgcaggccaggatatcgagcattttcgctgctag

DBGET integrated database retrieval system