Paraburkholderia acidisoli: FAZ98_31430 Help Entry FAZ98_31430       CDS       T07287                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pacs  Paraburkholderia acidisoli Pathway pacs00998   Biosynthesis of various antibiotics pacs01100   Metabolic pathways pacs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pacs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FAZ98_31430    00074 Mycolic acid biosynthesis     FAZ98_31430   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FAZ98_31430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  QGZ66308 UniProt:  A0A7Z2GRT1 LinkDB All DBs Position 4:614960..615205 Genome browser AA seq 81 aa AA seqDB search MSTIHQGNISERLKKCIAEITGLNAEEIADTSSFADLGCDSIELLEIVMAVEDEFGIEVS DDDGDKLKTVQQAIDYVTAKV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcacgatccaccaaggcaacatatccgaacgcctcaagaagtgtatcgccgagata acgggcctcaacgctgaagagatcgccgacacatcttctttcgctgacctcggttgcgat tccatcgaactactcgaaatcgtaatggctgtggaggacgaatttgggatcgaagtttcg gatgacgacggcgataagttgaagacggttcagcaggcgattgattacgttacggcgaaa gtttaa

DBGET integrated database retrieval system