Paraburkholderia acidisoli: FAZ98_32655 Help Entry FAZ98_32655       CDS       T07287                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pacs  Paraburkholderia acidisoli Brite KEGG Orthology (KO) [BR:pacs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pacs03032]     FAZ98_32655    03036 Chromosome and associated proteins [BR:pacs03036]     FAZ98_32655    03400 DNA repair and recombination proteins [BR:pacs03400]     FAZ98_32655 DNA replication proteins [BR:pacs03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FAZ98_32655 Chromosome and associated proteins [BR:pacs03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FAZ98_32655 DNA repair and recombination proteins [BR:pacs03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FAZ98_32655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 PT-TG Urease_beta DUF2267 HU-DNA_bdg Nup214_FG Motif Other DBs NCBI-ProteinID:  QGZ66525 UniProt:  A0A7Z2GRH1 LinkDB All DBs Position 4:837073..837351 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAASTGETKAATGAAIDAILEVVTRAVTSGDSVQLVGFGSFSTGQRAARVG RNPATGEEIQIAAAKTVKFTAGKAFKDAVNAS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactcattgacgcagtcgccgcaagcacgggcgaaaccaaggctgcc acgggcgccgcgatcgacgcgatcctcgaggtcgtcacgcgtgcggtcacgtcgggtgac tccgtgcagctcgtcggcttcggttcgttctcgactggccagcgtgccgctcgcgtgggc cgcaacccggccacgggcgaggagatccagattgccgctgcaaaaacggtgaagttcacc gcaggcaaggccttcaaggacgccgtcaacgcgtcgtga

DBGET integrated database retrieval system