Candidatus Pseudomonas adelgestsugas: C3B55_00877 Help Entry C3B55_00877       CDS       T05857                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pade  Candidatus Pseudomonas adelgestsugas Pathway pade01100   Metabolic pathways pade01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pade00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C3B55_00877 (acpP)    00074 Mycolic acid biosynthesis     C3B55_00877 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C3B55_00877 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QAX82186 LinkDB All DBs Position complement(1550325..1550558) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEVTSSASFVEDLGADSLDTVELVMALEEEFETEIPDEEAE KITTVQAAIDYVTAHQA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatagttgctgagcaactgggtgttaaagaa gaagtgaccagttctgcttccttcgttgaagatctgggtgccgactcccttgacacagtc gagctagtgatggccttggaagaggaatttgaaactgaaatcccagacgaagaagctgaa aaaattaccactgtgcaagctgctattgactacgttactgcccatcaagcgtaa

DBGET integrated database retrieval system