Pygoscelis adeliae (Adelie penguin): 103912150 Help Entry 103912150         CDS       T06012                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism padl  Pygoscelis adeliae (Adelie penguin) Brite KEGG Orthology (KO) [BR:padl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:padl03036]     103912150   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:padl04147]     103912150 Chromosome and associated proteins [BR:padl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103912150 Exosome [BR:padl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103912150 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  103912150 NCBI-ProteinID:  XP_009322689 LinkDB All DBs Position Unknown AA seq 72 aa AA seqDB search LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM PKDIQLARRIRG NT seq 218 nt NT seq  +upstreamnt  +downstreamnt ctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaagacc gacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctacctg gtggggctcttcgaggacaccaacctctgcgccatccacgccaagcgcgtcaccatcatg cccaaggacatccagctggcccgccgcatccgcggcga

DBGET integrated database retrieval system