Pygoscelis adeliae (Adelie penguin): 103912618 Help Entry 103912618         CDS       T06012                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism padl  Pygoscelis adeliae (Adelie penguin) Pathway padl04814   Motor proteins padl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:padl00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     103912618 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103912618 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:padl03037]     103912618 (DYNLT3)    04812 Cytoskeleton proteins [BR:padl04812]     103912618 (DYNLT3) Cilium and associated proteins [BR:padl03037]  Motile cilia and associated proteins   Dynein arm    103912618 (DYNLT3) Cytoskeleton proteins [BR:padl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      103912618 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  103912618 NCBI-ProteinID:  XP_009317189 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search MIFNADEAHNIVKELGYAFRYCRSSSEDFVIESVLGKADYNHNKVNQWTAAIVEQSLTHL VKLGKTYKYIVTCAVMQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAII L NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgatcttcaatgctgatgaggcgcacaacatagttaaggagctggggtatgcatttcgc tattgtcgctctagctctgaagactttgtcatagaaagtgttttaggcaaggcagattat aatcacaacaaagtcaaccagtggaccgctgctatagtagaacagtcgctgacacatctg gtaaaactcggaaagacgtacaagtacatcgtaacctgtgctgtgatgcagaggagtgga gctggtcttcacactgcaagctcgtgcttctgggatactacaactgatggaacctgcaca gtgagatgggaaaaccgaacaatgaactgcattgtcaatgtgtttgctgttgctattatc ctgtag

DBGET integrated database retrieval system