Pygoscelis adeliae (Adelie penguin): 103920695 Help Entry 103920695         CDS       T06012                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism padl  Pygoscelis adeliae (Adelie penguin) Pathway padl04010   MAPK signaling pathway padl04068   FoxO signaling pathway padl04081   Hormone signaling padl04114   Oocyte meiosis padl04140   Autophagy - animal padl04150   mTOR signaling pathway padl04810   Regulation of actin cytoskeleton padl04910   Insulin signaling pathway padl04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:padl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103920695 (INS)    04068 FoxO signaling pathway     103920695 (INS)    04150 mTOR signaling pathway     103920695 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     103920695 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103920695 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     103920695 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103920695 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103920695 (INS)    04914 Progesterone-mediated oocyte maturation     103920695 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:padl04052]     103920695 (INS) Cytokines and neuropeptides [BR:padl04052]  Neuropeptides   Unclassified    103920695 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  103920695 NCBI-ProteinID:  XP_009326802 UniProt:  A0A093PDE2 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIQSLPLLALLALSGPGTSHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQ PLVSGPLHDEVGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccaatcgctgcctctcctggcccttcttgctctttctggccctggg accagccacgcggctgccaaccagcacctctgcggctcccacttggtggaggctctctac ctggtgtgtggagagcggggtttcttctactcccccaaagcccgacgggacgttgagcag cctctagtgagcggtcccttgcatgatgaggtaggggagctgcccttccaacaggaggag tttgagaaagtgaagcgagggatcgttgagcaatgctgccacaacacatgctccctctac caactggaaaactactgcaactag

DBGET integrated database retrieval system