Pygoscelis adeliae (Adelie penguin): 103923578 Help Entry 103923578         CDS       T06012                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism padl  Pygoscelis adeliae (Adelie penguin) Pathway padl04010   MAPK signaling pathway padl04012   ErbB signaling pathway padl04068   FoxO signaling pathway padl04137   Mitophagy - animal padl04140   Autophagy - animal padl04150   mTOR signaling pathway padl04210   Apoptosis padl04218   Cellular senescence padl04370   VEGF signaling pathway padl04371   Apelin signaling pathway padl04540   Gap junction padl04625   C-type lectin receptor signaling pathway padl04810   Regulation of actin cytoskeleton padl04910   Insulin signaling pathway padl04912   GnRH signaling pathway padl04916   Melanogenesis Brite KEGG Orthology (KO) [BR:padl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103923578 (NRAS)    04012 ErbB signaling pathway     103923578 (NRAS)    04370 VEGF signaling pathway     103923578 (NRAS)    04371 Apelin signaling pathway     103923578 (NRAS)    04068 FoxO signaling pathway     103923578 (NRAS)    04150 mTOR signaling pathway     103923578 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103923578 (NRAS)    04137 Mitophagy - animal     103923578 (NRAS)   09143 Cell growth and death    04210 Apoptosis     103923578 (NRAS)    04218 Cellular senescence     103923578 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     103923578 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103923578 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103923578 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103923578 (NRAS)    04912 GnRH signaling pathway     103923578 (NRAS)    04916 Melanogenesis     103923578 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:padl04131]     103923578 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:padl04147]     103923578 (NRAS)    04031 GTP-binding proteins [BR:padl04031]     103923578 (NRAS) Membrane trafficking [BR:padl04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103923578 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103923578 (NRAS) Exosome [BR:padl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103923578 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    103923578 (NRAS)   Exosomal proteins of breast cancer cells    103923578 (NRAS)   Exosomal proteins of colorectal cancer cells    103923578 (NRAS) GTP-binding proteins [BR:padl04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103923578 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase Motif Other DBs NCBI-GeneID:  103923578 NCBI-ProteinID:  XP_009330237 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MGGSRCGHGRAGGGRCGTAGGEDPGRGALFCLCILQDSYRKQVVIDGETCLLDILDTAGQ EEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLP TRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNEDGNQGC MGLSCIVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgggggggagccggtgcggccacggccgagccggcggcgggaggtgcgggacggccggc ggggaggaccccgggaggggagctttgttttgcttgtgtattttgcaggattcatataga aagcaggttgttattgatggagagacgtgcttgttagacatcctggacactgcgggacag gaagaatatagtgccatgcgtgatcagtacatgagaactggggaaggattcctctgtgtt tttgccattaacaacagtaaatcgtttgctgatattaacctttacagagaacagatcaag agagtgaaagattcagatgatgtgccaatggtgctagttgggaataagtgtgatttgccc acaagaacagtagacacaaaacaggctcaagaattagcaaaaagctatggaatccccttc atagagacatctgctaaaacaagacagggtgtggaagatgctttttacacactggtgaga gagatccggcagtaccggatgaaaaagctcaacagcaacgaagatgggaatcaaggctgt atgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system