Pygoscelis adeliae (Adelie penguin): 103925395 Help Entry 103925395         CDS       T06012                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism padl  Pygoscelis adeliae (Adelie penguin) Pathway padl03272   Virion - Hepatitis viruses padl04382   Cornified envelope formation padl04514   Cell adhesion molecules padl04530   Tight junction Brite KEGG Orthology (KO) [BR:padl00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     103925395 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     103925395 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     103925395 (CLDN1)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103925395 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:padl03037]     103925395 (CLDN1)    04147 Exosome [BR:padl04147]     103925395 (CLDN1)    04515 Cell adhesion molecules [BR:padl04515]     103925395 (CLDN1) Cilium and associated proteins [BR:padl03037]  Other cilia and associated proteins   Stereociliary proteins    103925395 (CLDN1) Exosome [BR:padl04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    103925395 (CLDN1)   Exosomal proteins of colorectal cancer cells    103925395 (CLDN1) Cell adhesion molecules [BR:padl04515]  Immunoglobulin superfamily   L1 family    103925395 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF981 Cytochrom_B_C Voltage_CLC CD20 DUF1218 OppC_N DUF4134 HlyIII DUF898 DUF7269 DUF2157 Motif Other DBs NCBI-GeneID:  103925395 NCBI-ProteinID:  XP_009332380 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MRSLQATRALMVAAILLGLVAVFVAVTGMKCMKCMEDDQVKKMRMAVFGGVIFIIAGLAA LVATSWYGNRVARAFYDPFTPVNTRFEFGSALFIGWAAASLAMLGGAFLCCSCPRRETSY PPTRGYPKNAPSTGKDYV NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtctgcaggccactcgggctttgatggtggctgcaatactcctgggccttgtc gctgtatttgttgctgtgactggcatgaaatgcatgaagtgcatggaagatgaccaggtg aagaagatgcggatggctgtctttggtggggtgatcttcatcattgcaggtttggcagcg ctggtggccacgtcatggtatggcaacagagtggctcgggccttttacgaccctttcact cctgtcaacaccagatttgagtttggatcagctctcttcattggctgggcagctgcttct ctggccatgctggggggagccttcctctgctgctcctgtccacggagagaaacttcatat ccacccacccgaggctatccaaaaaatgccccctccacagggaaggattatgtataa

DBGET integrated database retrieval system