Pygoscelis adeliae (Adelie penguin): 103925789 Help Entry 103925789         CDS       T06012                                  Symbol FTH1 Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism padl  Pygoscelis adeliae (Adelie penguin) Pathway padl00860   Porphyrin metabolism padl04216   Ferroptosis padl04217   Necroptosis Brite KEGG Orthology (KO) [BR:padl00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     103925789 (FTH1)  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     103925789 (FTH1)    04217 Necroptosis     103925789 (FTH1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:padl04147]     103925789 (FTH1) Enzymes [BR:padl01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      103925789 (FTH1) Exosome [BR:padl04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103925789 (FTH1)   Exosomal proteins of bladder cancer cells    103925789 (FTH1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin YppF Motif Other DBs NCBI-GeneID:  103925789 NCBI-ProteinID:  XP_009332835 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MKLQNQRGGRIFLQDIKKPDRDDWENGLTAMECALHLEKNVNQSLLELHKLATEKNDPHL CDFIETHYLDEQVKSIKELGDHVTNLRKMGAPKYGMAEYLFDKHTLGDSDNES NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaagctacaaaaccagaggggcggacgcatcttcttgcaggacatcaagaagccagat cgtgatgactgggagaatggactgactgcaatggagtgtgccctgcacctggagaagaat gtgaaccagtcactgttagaactgcacaaattggcaactgaaaagaatgacccacacttg tgtgacttcattgagactcactacctggatgaacaggtgaaatccatcaaagagctgggt gaccatgtgaccaacctgcggaagatgggggcaccgaaatacggcatggcagagtacctc tttgacaagcacaccctaggggacagtgacaatgagagctga

DBGET integrated database retrieval system