Pygoscelis adeliae (Adelie penguin): 26737708 Help Entry 26737708          CDS       T06012                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism padl  Pygoscelis adeliae (Adelie penguin) Pathway padl00190   Oxidative phosphorylation padl01100   Metabolic pathways Module padl_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:padl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     26737708 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:padl03029]     26737708 (ND4L) Enzymes [BR:padl01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      26737708 (ND4L) Mitochondrial biogenesis [BR:padl03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     26737708 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Arv1 Motif Other DBs NCBI-GeneID:  26737708 NCBI-ProteinID:  YP_007890940 UniProt:  D2JN31 LinkDB All DBs Position MT AA seq 98 aa AA seqDB search MSFMHLSFYSAFALSSLGLAFHRTHLISALLCLESMMLSMYIALSIWPIENQAPSFTLMP MLMLTFSACEAGAGLAMLVASTRTHGSDHLHNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtccttcatacacctaagcttctactcagcattcgccctaagcagcctaggactagct ttccaccggacccacctaatctcagccctactctgcctagagagcatgatactatccata tacatcgccctgtcaatttgacccatcgaaaaccaagccccctccttcacccttatacct atactcatactcacattctccgcctgcgaagcaggtgcaggcctagccatactagttgcc tcaacccgaactcacggctccgaccacttacacaacctaaacctcctacaatgctaa

DBGET integrated database retrieval system