KEGG Orthology (KO) [BR:pads00001]
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
140330583 (YWHAZ)
04114 Oocyte meiosis
140330583 (YWHAZ)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:pads03400]
140330583 (YWHAZ)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:pads04147]
140330583 (YWHAZ)
DNA repair and recombination proteins [BR:pads03400]
Eukaryotic type
Check point factors
Other check point factors
140330583 (YWHAZ)
Exosome [BR:pads04147]
Exosomal proteins
Proteins found in most exosomes
140330583 (YWHAZ)
153 aa
MDKNELVQKAKLAEQAERYDDMASCMKRVTEEGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGSDKKQQMAREYREKIESELREICNDVLCLLDKYLIANASQAESKVFYLK
MKGDYYRYLAEVACGDDKKSTLSLFCSLSLCLS