Pseudomonas aeruginosa PAO1: PA1804 Help Entry PA1804            CDS       T00035                                  Symbol hupB Name (RefSeq) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pae  Pseudomonas aeruginosa PAO1 Brite KEGG Orthology (KO) [BR:pae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pae03032]     PA1804 (hupB)    03036 Chromosome and associated proteins [BR:pae03036]     PA1804 (hupB)    03400 DNA repair and recombination proteins [BR:pae03400]     PA1804 (hupB) DNA replication proteins [BR:pae03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PA1804 (hupB) Chromosome and associated proteins [BR:pae03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PA1804 (hupB) DNA repair and recombination proteins [BR:pae03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PA1804 (hupB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 Barstar HU-CCDC81_euk_2 Motif Other DBs NCBI-GeneID:  878308 NCBI-ProteinID:  NP_250495 UniProt:  P05384 LinkDB All DBs Position 1958759..1959031 Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAASADIPKAVAGRALDAVIESVTGALKAGDSVVLVGFGTFAVKERAARTG RNPQTGKPIKIAAAKIPGFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtcggaactgatcgatgcaattgccgcatctgctgatatcccgaaagctgtt gccggtcgcgcactggacgcagtgatcgagtccgtcactggcgccctgaaggctggtgac tccgtcgtgctggttggtttcggcaccttcgctgtcaaagagcgcgctgctcgcaccggt cgcaacccgcaaactggcaagccgatcaagatcgccgctgccaagatcccgggcttcaaa gccggtaaagccctgaaggatgctgtcaactaa

DBGET integrated database retrieval system