Paenibacillus sp. FSL R7-0273: R70723_00235 Help Entry R70723_00235      CDS       T03356                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism paea  Paenibacillus sp. FSL R7-0273 Brite KEGG Orthology (KO) [BR:paea00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:paea03032]     R70723_00235    03036 Chromosome and associated proteins [BR:paea03036]     R70723_00235    03400 DNA repair and recombination proteins [BR:paea03400]     R70723_00235 DNA replication proteins [BR:paea03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     R70723_00235 Chromosome and associated proteins [BR:paea03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     R70723_00235 DNA repair and recombination proteins [BR:paea03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       R70723_00235 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 TGS HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AIQ44520 LinkDB All DBs Position 50462..50734 Genome browser AA seq 90 aa AA seqDB search MNKTDLVNNISEKSGLAKKDVEAVLNGVLSEITDALSKGDKVQLIGFGTFETRKRSGRTG RNPQSGTPIEIPESTVPAFKAGNKLKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacagatctggtaaacaacatttccgaaaaaagcggattggccaaaaaagat gtagaagccgtattaaacggtgtacttagcgaaattaccgatgctttgtccaagggtgat aaagtacagctgatcggcttcggtacttttgaaacacgcaagcgctccggccgtaccggc cgcaatccgcaatcgggcacgcctattgaaattcctgaatcgactgtaccggccttcaag gctggcaacaagctcaaagaagccgttaactaa

DBGET integrated database retrieval system