Paenibacillus sp. FSL R7-0273: R70723_12485 Help Entry R70723_12485      CDS       T03356                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism paea  Paenibacillus sp. FSL R7-0273 Pathway paea01100   Metabolic pathways paea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R70723_12485    00074 Mycolic acid biosynthesis     R70723_12485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R70723_12485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 ACP_SdgA_C OST48_N Motif Other DBs NCBI-ProteinID:  AIQ46600 LinkDB All DBs Position 2834080..2834328 Genome browser AA seq 82 aa AA seqDB search MISQEFIYELLERKFSVQTAGIHKDSKLRDLGLDSFDIFFFVAELENRLGCSIPDQDLLS FQRLGDVIDYMNRNQVKAGDNA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgatatcccaggaatttatttatgagcttttagaacgtaaattttctgtacaaacggca gggattcataaagactcgaagctgcgggatttgggtctcgacagctttgatattttcttt ttcgttgcagagctggagaacaggctcggctgtagtattcctgatcaggatttactgtct tttcagcggcttggtgatgtcattgactatatgaatcgtaatcaggtgaaggcgggggat aacgcttga

DBGET integrated database retrieval system