Pseudomonas aeruginosa NCGM 1900: NCGM1900_2942 Help Entry NCGM1900_2942     CDS       T03789                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism paeb  Pseudomonas aeruginosa NCGM 1900 Pathway paeb01100   Metabolic pathways paeb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paeb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCGM1900_2942    00074 Mycolic acid biosynthesis     NCGM1900_2942   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCGM1900_2942 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  BAP22043 UniProt:  A0AAQ3LPN4 LinkDB All DBs Position complement(3049566..3049805) Genome browser AA seq 79 aa AA seqDB search MPNDMEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGIDDEL DLLETVDELFQLVEKHRAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcccaacgacatggaagaccatctcctcaccgtgctcagcgtcgccagcggcgtgccg aaggaggaaatcagccgggacagcaggatggaagacctggctttcgattcgctggtggtc agcgagctgtcgctgaagttgcgcaaggagttcggcgtcaccgggatcgacgacgaactc gacctgctggaaacggtggacgaactgttccaactggtcgagaaacaccgcgccgcctga

DBGET integrated database retrieval system