Pseudohalocynthiibacter aestuariivivens: G5B38_02040 Help Entry G5B38_02040       CDS       T06463                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paed  Pseudohalocynthiibacter aestuariivivens Pathway paed01100   Metabolic pathways paed01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paed00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5B38_02040    00074 Mycolic acid biosynthesis     G5B38_02040   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5B38_02040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QIE44407 LinkDB All DBs Position 417642..417902 Genome browser AA seq 86 aa AA seqDB search MSDIPDRVIAIIAEQAVLEPSDVTMSSTLEELGIDSLGLVESIFAIEEEFDINVPFNANE PTESDFDISTVASIVAGITKLVKEQS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgacataccggaccgggtgatagccatcatcgcagagcaggctgtactggagcca tccgatgtcacgatgtcgagcacgctcgaagaactgggcatcgacagcctcggtctggtc gaaagcattttcgcgatcgaggaagaattcgacatcaacgttccgttcaatgccaacgaa ccgacagagagcgattttgacatctctaccgttgccagcatcgtggctggcatcacaaag ctggtgaaagagcagtcgtga

DBGET integrated database retrieval system