Pseudohalocynthiibacter aestuariivivens: G5B38_05645 Help Entry G5B38_05645       CDS       T06463                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paed  Pseudohalocynthiibacter aestuariivivens Pathway paed01100   Metabolic pathways paed01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paed00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5B38_05645    00074 Mycolic acid biosynthesis     G5B38_05645   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5B38_05645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QIE45055 LinkDB All DBs Position complement(1191849..1192082) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIKEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcagaccgcgtgaagaaaatcgttgtagagcacttgggcgtggaagaa gacaaagtgactgagaacgcttcgttcatcgacgatctgggcgcagacagcctagacacg gtcgagctggtcatggcgttcgaagaagagttcggcatcgagatccccgacgacgcggct gaaaccatccagacgttcggcgatgcggtgaagttcatcaaagaagcatcctga

DBGET integrated database retrieval system