Paenibacillus sp. FSL R7-0331: R70331_00240 Help Entry R70331_00240      CDS       T03357                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism paee  Paenibacillus sp. FSL R7-0331 Brite KEGG Orthology (KO) [BR:paee00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:paee03032]     R70331_00240    03036 Chromosome and associated proteins [BR:paee03036]     R70331_00240    03400 DNA repair and recombination proteins [BR:paee03400]     R70331_00240 DNA replication proteins [BR:paee03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     R70331_00240 Chromosome and associated proteins [BR:paee03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     R70331_00240 DNA repair and recombination proteins [BR:paee03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       R70331_00240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 TGS HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AIQ50137 UniProt:  A0A089KNW1 LinkDB All DBs Position 50432..50704 Genome browser AA seq 90 aa AA seqDB search MNKTDLVNNISEKSGLAKKDVEAVLNGVLSEITDALSKGDKVQLIGFGTFETRKRSGRTG RNPQSGTPIEIPESTVPAFKAGNKLKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacagatctggtaaacaacatttccgaaaaaagcggattggcaaaaaaagat gtagaagccgtattgaacggtgtacttagcgaaattaccgatgctttgtccaagggtgat aaagtacagctgatcggcttcggtacttttgaaacacgcaaacgttccggccgtaccggc cgcaacccgcaatcgggcacacctattgaaattcctgaatcgactgtaccagcctttaag gctggcaacaagctcaaagaagccgttaattaa

DBGET integrated database retrieval system