Paenibacillus sp. FSL R5-0345: R50345_20810 Help Entry R50345_20810      CDS       T03333                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism paef  Paenibacillus sp. FSL R5-0345 Brite KEGG Orthology (KO) [BR:paef00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:paef03032]     R50345_20810    03036 Chromosome and associated proteins [BR:paef03036]     R50345_20810    03400 DNA repair and recombination proteins [BR:paef03400]     R50345_20810 DNA replication proteins [BR:paef03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     R50345_20810 Chromosome and associated proteins [BR:paef03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     R50345_20810 DNA repair and recombination proteins [BR:paef03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       R50345_20810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 Ribosomal_L12 HU-DNA_bdg HU-CCDC81_euk_1 Rpf1_C Motif Other DBs NCBI-ProteinID:  AIQ36868 LinkDB All DBs Position complement(4561103..4561375) Genome browser AA seq 90 aa AA seqDB search MNKSDLINVVTEATELPKKDATKAVDAVFEAITEALQSGDKVQLVGFGNFEVRERSARKG RNPQTGEEIEIPASKVPAFKPGKALKDGIK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatctgatttgatcaatgtagttacagaagcaactgaacttcccaagaaggat gctactaaagctgtagatgcggttttcgaagcaattacagaagcactgcaaagcggtgac aaagtacaactggttggattcggaaactttgaagtgcgcgaacgttccgcacgtaaaggc cgtaacccacaaactggtgaagaaatcgaaattcctgcaagcaaggtgccagctttcaaa cctggtaaggcgctgaaagacggaatcaaataa

DBGET integrated database retrieval system