Pseudomonas aeruginosa YL84: AI22_23305 Help Entry AI22_23305        CDS       T03035                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paeg  Pseudomonas aeruginosa YL84 Pathway paeg01100   Metabolic pathways paeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AI22_23305 (acpP)    00074 Mycolic acid biosynthesis     AI22_23305 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AI22_23305 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHH51776 LinkDB All DBs Position complement(5044024..5044260) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEKA EKITTVQEAIDYIVAHQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgctgaacaactcggcgtgaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gtcgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgagaaagct gaaaagatcaccaccgttcaggaagccatcgactacatcgttgctcaccagcaataa

DBGET integrated database retrieval system