Pseudomonas aeruginosa YL84: AI22_25210 Help Entry AI22_25210        CDS       T03035                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paeg  Pseudomonas aeruginosa YL84 Pathway paeg01100   Metabolic pathways paeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AI22_25210    00074 Mycolic acid biosynthesis     AI22_25210   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AI22_25210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AHH52135 LinkDB All DBs Position 5455135..5455374 Genome browser AA seq 79 aa AA seqDB search MPNDMEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDEL DLLETVDELFQLVEKHRAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcccaacgacatggaagaccatctcctcaccgtgctcagcgtcgccagcggcgtgccg aaggaggaaatcagccgggacagcaggatggaagacctggctttcgattcgctggtggtc agcgagctgtcgctgaagctgcgcaaggagttcggcgtcaccggggtcgacgacgaactc gacctgctggaaacggtggacgaactgttccagctggtcgagaagcaccgcgccgcctga

DBGET integrated database retrieval system