Paenibacillus sp. FSL H7-0357: H70357_23690 Help Entry H70357_23690      CDS       T03358                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism paeh  Paenibacillus sp. FSL H7-0357 Brite KEGG Orthology (KO) [BR:paeh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:paeh03032]     H70357_23690    03036 Chromosome and associated proteins [BR:paeh03036]     H70357_23690    03400 DNA repair and recombination proteins [BR:paeh03400]     H70357_23690 DNA replication proteins [BR:paeh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     H70357_23690 Chromosome and associated proteins [BR:paeh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     H70357_23690 DNA repair and recombination proteins [BR:paeh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       H70357_23690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AIQ19380 UniProt:  A0A089I8J8 LinkDB All DBs Position complement(5197651..5197923) Genome browser AA seq 90 aa AA seqDB search MNKSDLINVVTEATELPKKDATKAVDAVFEAITGALQSGDKVQLVGFGNFEVRERSARKG RNPQTGEEIEIPSSKVPAFKPGKALKDGIK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcagatttgatcaacgtagtaacagaagcaactgaacttcccaagaaagat gctactaaagcggtagatgccgttttcgaagcgatcacaggtgctctgcaaagcggcgat aaagtacaactggttggattcggaaactttgaagtgcgcgaacgttccgcacgtaaaggc cgcaacccgcaaactggtgaagaaatcgaaattccttcaagcaaagtaccggcattcaaa cccggtaaggcgcttaaagacggaatcaaatag

DBGET integrated database retrieval system