Paenibacillus sp. FSL H7-0737: H70737_00300 Help Entry H70737_00300      CDS       T03359                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism paej  Paenibacillus sp. FSL H7-0737 Brite KEGG Orthology (KO) [BR:paej00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:paej03032]     H70737_00300    03036 Chromosome and associated proteins [BR:paej03036]     H70737_00300    03400 DNA repair and recombination proteins [BR:paej03400]     H70737_00300 DNA replication proteins [BR:paej03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     H70737_00300 Chromosome and associated proteins [BR:paej03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     H70737_00300 DNA repair and recombination proteins [BR:paej03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       H70737_00300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AIQ21443 UniProt:  A0A089IG03 LinkDB All DBs Position 63078..63350 Genome browser AA seq 90 aa AA seqDB search MNKTDLVNNISEKNGLAKKDVEAVLNGFLGEITEALAKGDKVQLIGFGTFETRKRAGRTG RNPQTGTTIEIPESTVPAFKAGNKLKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacagatttggtaaacaacatttccgagaaaaacggattggcaaaaaaagat gtagaagcagtattgaacggattcttgggtgagattacagaagctttggcaaaaggtgat aaagtccaactgatcggtttcggaacttttgaaactcgcaaacgtgcaggacgcactggt cgcaacccgcaaacgggcactacgattgaaattccagaatcgactgtaccggctttcaaa gctggtaacaagcttaaagaagccgttaactaa

DBGET integrated database retrieval system