Pseudomonas aeruginosa LES431: T223_06955 Help Entry T223_06955        CDS       T02970                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pael  Pseudomonas aeruginosa LES431 Brite KEGG Orthology (KO) [BR:pael00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pael03036]     T223_06955 Chromosome and associated proteins [BR:pael03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     T223_06955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC NRBF2 Mod_r YabA Motif Other DBs NCBI-ProteinID:  AHC64039 LinkDB All DBs Position 1469530..1469814 Genome browser AA seq 94 aa AA seqDB search MRLRSPYWLFVVLILALAGLQYRLWVGDGSLAQVRDLQKQIADQHGENERLLERNRILEA EVAELKKGTETVEERARHELGMVKDGETLYQLAK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt ttgaggttacgtagcccctactggctgttcgtggtgctgatcctggcgctggcgggcctg caatatcgcctgtgggtcggcgatggcagcctggcgcaggtgcgcgacctgcagaagcag atcgccgaccagcatggcgagaacgagcgcctgctggagcgcaaccggattctcgaagcc gaagtcgccgagctgaagaaaggcaccgagaccgtcgaggagcgtgcgcggcacgagctc ggcatggtcaaggacggcgaaaccctctaccagctcgccaagtga

DBGET integrated database retrieval system