KEGG   Pseudomonas aeruginosa LES431: T223_24185
Entry
T223_24185        CDS       T02970                                 
Name
(GenBank) hypothetical protein
  KO
K07490  ferrous iron transport protein C
Organism
pael  Pseudomonas aeruginosa LES431
Brite
KEGG Orthology (KO) [BR:pael00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pael02000]
    T223_24185
Transporters [BR:pael02000]
 Other transporters
  Others
   T223_24185
SSDB
Motif
Pfam: FeoC HTH_Cmi2_C FeoB_associated FCH HTH_IclR
Other DBs
NCBI-ProteinID: AHC67372
LinkDB
Position
complement(5165667..5165909)
AA seq 80 aa
MATLMQLRAALEDGQARGLKQLSRQVDAPPALVEAILERLIALGKVERVAAQSSGGCGGG
CKGCAQRDPCAEPEPHFRLR
NT seq 243 nt   +upstreamnt  +downstreamnt
atggcgacactcatgcagctccgcgccgccctggaagacggccaggcgcgtgggctgaaa
cagctcagccgccaggtggacgcgccgccggcgctggtggaggcgatcctggagcggctg
atcgcgctcggcaaggtcgagcgggtggctgcgcaaagctcgggcggttgcggcggtggt
tgcaagggctgcgcccagcgcgatccgtgcgcggaaccggagccgcatttccgcctgcgc
tag

DBGET integrated database retrieval system