Pseudomonas aeruginosa MTB-1: U769_10105 Help Entry U769_10105        CDS       T02951                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paem  Pseudomonas aeruginosa MTB-1 Pathway paem01100   Metabolic pathways paem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U769_10105 (acpP)    00074 Mycolic acid biosynthesis     U769_10105 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U769_10105 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHB55259 LinkDB All DBs Position 2167689..2167925 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEKA EKITTVQEAIDYIVAHQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgctgaacaactcggcgtgaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gtcgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgagaaagct gaaaagatcaccaccgttcaggaagccatcgactacatcgttgctcaccagcaataa

DBGET integrated database retrieval system